The URL can be used to link to this page

Home My WebLink About2015 Annual Inspection Report_Dry Creek Mine Department of Conservation OFFICE OF MINE RECLAMATION SMARA LEAD AGENCY INSPECTION NOTICE FORM (This form is provided for the convenience of lead agencies. See instructions on the back of the form.) 7R 5HSRUWLQJ8QLW &DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ 2IILFHRI0LQH5HFODPDWLRQ .6WUHHW06 6DFUDPHQWR&$ )URP 'DWHRIWKLV1RWLFH 6XEMHFW/HDG$JHQF\,QVSHFWLRQ1RWLFH3XUVXDQWWR35&E BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6LJQDWXUHDQG7LWOHRI/HDG$JHQF\5HSUHVHQWDWLYH 6HHLQVWUXFWLRQVRQEDFNRIIRUP ,FHUWLI\WKDWWKLVVXUIDFHPLQLQJRSHUDWLRQLVLQFRPSOLDQFHZLWK60$5$PLQLQJRSHUDWLRQLVSHUPLWWHG >RUYHVWHG@FRQVLVWHQWZLWKUHFODPDWLRQSODQWKHILQDQFLDODVVXUDQFHLVDGHTXDWHIRUUHFODPDWLRQ FRVWVDQGQRYLRODWLRQVZHUHFLWHGRQWKH055&LQVSHFWLRQIRUP &KHFNDSSOLFDEOHER[ Yes No,IQRZKLFKDVSHFWVRIWKHRSHUDWLRQVDUHLQFRQVLVWHQWZLWK60$5$: 'RHVWKHVXUIDFHPLQLQJRSHUDWLRQKDYHDUHYLHZRILWVUHFODPDWLRQSODQILQDQFLDODVVXUDQFHVRUDQ LQWHULPPDQDJHPHQWSODQSHQGLQJXQGHUVXEGLYLVLRQEFGRUKRI6HFWLRQRUDQDSSHDO SHQGLQJEHIRUHWKHERDUGRUOHDGDJHQF\JRYHUQLQJERG\XQGHUVXEGLYLVLRQHRUKRI6HFWLRQ" Yes No $UHWKHFRPSOHWHG055&LQVSHFWLRQIRUPDQGDQ\VXSSRUWLQJGRFXPHQWDWLRQLQFOXGLQJEXWQRW OLPLWHGWRDQ\LQVSHFWLRQUHSRUWSUHSDUHGE\WKHOLFHQVHGJHRORJLVWFLYLOHQJLQHHUODQGVFDSHDUFKLWHFW RUIRUHVWHUZKRFRQGXFWHGWKHLQVSHFWLRQDWWDFKHG"Yes No 'DWHRI,QVSHFWLRQ0LQH,' ¹óûðåòè¯íçïéðºéòíóö·ðåòòéö Butte County Department of Development Services 7 County Center Drive Oroville, CA 95965 December 23, 2015 December 11, 2015 04-0012 ✔ ✔ ✔ INSPECTION NOTICE FORM INSTRUCTIONS 7KHVSHFLILF60$5$VWDWXWHWKDWUHTXLUHVWKHLQVSHFWLRQQRWLFHLVTXRWHGEHORZ ³35&E«7KHOHDGDJHQF\VKDOOQRWLI\WKHGLUHFWRUZLWKLQGD\VRIWKHGDWHRIFRPSOHWLRQRI WKHLQVSHFWLRQWKDWWKHLQVSHFWLRQKDVEHHQFRQGXFWHG7KHQRWLFHVKDOOFRQWDLQDVWDWHPHQWUHJDUGLQJ WKHVXUIDFHPLQLQJRSHUDWLRQ VFRPSOLDQFHZLWK WKLVFKDSWHUVKDOOLQFOXGHDFRS\RIWKHFRPSOHWHG LQVSHFWLRQ IRUP DQG VKDOO VSHFLI\ ZKLFK DVSHFWV RI WKH VXUIDFHPLQLQJRSHUDWLRQVLIDQ\DUH LQFRQVLVWHQWZLWKWKLVFKDSWHU,IWKHVXUIDFHPLQLQJRSHUDWLRQKDVDUHYLHZRILWVUHFODPDWLRQSODQ ILQDQFLDODVVXUDQFHVRUDQLQWHULPPDQDJHPHQWSODQSHQGLQJXQGHUVXEGLYLVLRQEFGRUKRI 6HFWLRQRUDQDSSHDOSHQGLQJEHIRUHWKHERDUGRUOHDGDJHQF\JRYHUQLQJERG\XQGHUVXEGLYLVLRQ HRUKRI6HFWLRQWKHQRWLFHVKDOOVRLQGLFDWH7KHOHDGDJHQF\VKDOOIRUZDUGWRWKHRSHUDWRUD FRS\ RI WKH QRWLFH D FRS\ RI WKH FRPSOHWHG LQVSHFWLRQ IRUP DQG DQ\ VXSSRUWLQJ GRFXPHQWDWLRQ LQFOXGLQJEXWQRWOLPLWHGWRDQ\LQVSHFWLRQUHSRUWSUHSDUHGE\WKHJHRORJLVWFLYLOHQJLQHHUODQGVFDSH DUFKLWHFWRUIRUHVWHUZKRFRQGXFWHGWKHLQVSHFWLRQ´ 3OHDVHXVHWKHDWWDFKHGVXJJHVWHG60$5$/($'$*(1&<,163(&7,21127,&()250RU\RXU RZQIRUPRUOHWWHUIRUPDWWRSURYLGHWKHLQIRUPDWLRQUHTXLUHGSXUVXDQWWR35&E 3OHDVHQRWHZKHWKHUYLRODWLRQVFLWHGLQWKH055&KDYHEHHQFRUUHFWHGDWWKHGDWHRIWKLV QRWLFH. State of California DEPARTMENT OF CONSERVATION OFFICE OF MINE RECLAMATION MRRC-1 (4/97) Page 1 of 5 (Rev. 07/13) SURFACE MINING INSPECTION REPORT (See reverse side of each form page for completion instructions) I. Mine Name (As Shown on Approved Reclamation Plan)Inspection Date:CA MINE ID# 91- II. Mine Operator Telephone ( ) Onsite Contact Person Telephone ( ) Mailing Address City State ZIP Code E-mail Address (optional) III. Designated Agent Telephone ( ) Mailing Address City State ZIP Code E-mail Address (optional) IV. SMARA Lead Agency Name (City, County, BCDC, or SMGB) Inspector Telephone ( ) Title Organization Mailing Address City State ZIP Code E-mail Address (optional) V. Does the operation have:P NR No Yes A Permit to Mine Permit # - Start and Expiration Dates Vested Right to Mine Year of Lead Agency determination A Reclamation Plan RP# Date Approved Reclamation Plan Amendment RP Amendment # (as applies) Date Approved or Status of Amendment Has the Operator filed a Mining Operation Annual Report (Form MRRC-2) this Year? Check One:Yes No Year of Most Recent Filed Annual Report: VI. Is this Operation on Federal Land? Check One:If "Yes,”Provide One or Both of the Federal Mine Land Identification Numbers Below:Yes No California Mining Claim Number (CAMC#):Latitude/Longitude at Mine Entrance (Decimal Degrees): U.S. Forest Service or BLM Identification Number (Plan of Operations #) :Status of Plan of Operations (Current/Expired/In Process): DISTRIBUTION: Lead Agency sends copies of Inspection notice & completed MRRC-1 to operator, operator’s designated agent, BLM or USFS (if required) & retains original. Dry Creek Mine December 11, 2015 04-0012 Franklin Construction, Inc.530 343-9600 John Weimer 530 343-9600 PO Box 3100 Chico California 95927 jweimer@franklinconstruction.com Rodney Winkle 530 343-9600 PO Box 3100 Chico California 95927 rod@franklinconstruction.com Butte County Rowland Hickel 530 538-7150 Senior Planner Department of Development Services 7 County Center Drive Oroville California 95965 rhickel@buttecounty.net MRP 93-01 September 23, 1993 MRP 93-01 September 23, 1993 ✔ ✔2014 ✔ N/A 39.619785 / -121.629468 N/A N/A INSTRUCTIONS FOR COMPLETING SURFACE MINING INSPECTION REPORT Form MRRC-1 (4/97) Page 1 (Rev. 07/13) This report is intended to comply with the requirements of California’s Surface Mining and Reclamation Act (SMARA – Public Resources Code Sections §§ 2710 et seq., and the associated California Code of Regulations found in Title 14, division 2, beginning at § 3500, hereinafter respectively “PRC” or “CCR”) and specifically PRC § 2774(b) and CCR § 3504.5 for operations located on private land and/or partly or solely on Bureau of Land Management (BLM) and U.S. Forest Service (USFS) lands (Title 43, parts 3500, 3600, and 3800 of the Code of Federal Regulations). A Memorandum of Understanding between the U.S. Department of Interior, BLM; U.S. Department of Agriculture, USFS; the State of California, Department of Conservation; and the State Mining and Geology Board (SMGB), discusses implementation of SMARA on Federal lands in California that are under the jurisdiction of the BLM and/or the USFS. As required by PRC § 2774(b) and CCR § 3504.5(g), Lead Agencies shall file an Inspection Notice that includes a statement regarding compliance with SMARA, a copy of this Surface Mining Inspection Report (MRRC-1) and any other supporting documentation with the Department within 30 days of completion of the inspection. The Lead Agency shall also forward a copy of the Inspection Notice, MRRC-1, and any supporting documentation to the operator. BLOCK I: Enter the name of the Mining Operation, the date of the inspection, and the California Mine ID number. BLOCK II: Enter the name of the Mine Operator, mailing address, phone number, name, and email address (optional) of the person to serve as the onsite contact. BLOCK III: Enter the name, mailing address, phone number, and email (optional) of the Designated Agent who, under PRC § 2772(c)(1) and 2207(a)(1), will serve as a contact for any follow-up correspondence or discussions regarding the inspection or noted violations. BLOCK IV: For "Lead Agency," enter the name of the certified SMARA Lead Agency that is conducting this inspection. Acceptable entries include the name of the city, county, Bay Conservation and Development Commission (BCDC), or State Mining and Geology Board (SMGB). For "Organization," enter the name of the agency, firm or other organization that employs the inspector. BLOCK V:Check the appropriate boxes. P NR, No, Yes Pending (on appeal or awaiting approval by Lead Agency) Not required for this operation at the time this inspection was completed No Yes, supply information Note: Where appropriate, to aid in determining when the lead agency recognized that the operation has vested mining rights, inspectors are advised to review older agency correspondence, minutes of lead agency hearings, including agendas and staff reports associated with approvals of any kind related to the mining operation. BLOCK VI: Indicate if the operation is on federal Land; if operation is on federal land, include a California Mining Claim Number and/or a BLM/USFS Identification Number and Plan of Operations Number, if applicable. Give the status of the BLM/USFS Plan of Operations, as indicated. Give the latitude and longitude at the mine entrance in decimal degrees. ___________________________________________________________________________________________________________________________________________ DISTRIBUTION INSTRUCTIONS: One copy of the inspection notice and this completed Inspection Report (all pages) shall be given to the Mine Operator and the operator’s designated agent by the lead agency (PRC Section 7374(b). The Lead Agency must retain the original copy of this Inspection Report and submit one copy of this Inspection Report, along with an original inspection report notice (PRC Subsection 2774(b)), within 30-days of the completion of the inspection, to: Department of Conservation Office of Mine Reclamation 801 K St MS 09-06 Sacramento, CA 95814-3529 If any part of the operation inspected is on BLM or USFS land, one copy of this Inspection Report should be forwarded to the appropriate BLM or USFS office. State of California DEPARTMENT OF CONSERVATION OFFICE OF MINE RECLAMATION MRRC-1 (4/97) Page 2 of 5 (Rev. 07/13) SURFACE MINING INSPECTION REPORT VII. Financial Assurance Inspection Date:CA MINE ID#: 91- Type of Financial Assurance Mechanism(s) Financial Assurance Mechanism Number(s)Amount of Mechanism Date of Expiration Date of Lead Agency Approval of Mechanism Total Amount of Mechanism(s) Financial Assurance Mechanism Pending Review by Lead Agency? If yes, provide date submitted/explanation and amount of pending mechanism: Has there been a change of operator since last inspection? If yes provide the date of notice. Yes No Date of Change: If yes, has the new operator posted a Financial Assurance Mechanism? Yes No If not, describe status of new operators Financial Assurance Mechanism: Does new operator’s Notice of Change include a statement of responsibility for reclamation? Yes No Date and Amount of Most Recent Approved Financial Assurance Cost Estimate: Date: Amount: Financial Assurance Cost Estimate Pending Review with Lead Agency? Date Submitted/Explanation/Amount of pending estimate: Financial Assurance Cost Estimate Appealed by Operator? Date Submitted to State Mining and Geology Board or Lead Agency for Appeal/Explanation: Other? DISTRIBUTION: Lead Agency sends copies of Inspection notice & completed MRRC-1 to operator, operator’s designated agent, BLM or USFS (if required) & retains original. December 11, 2015 04-0012 Bond #124-106-895 $93,334.30 Continuous 05/12/14 $93,334.30 ✔ February 12, 2014 $93,334.30 N/A N/A INSTRUCTIONS FOR COMPLETING SURFACE MINING INSPECTION REPORT Form MRRC-1 (4/97) Page 2 (Rev. 07/13) BLOCK VII: Type of Financial Assurance Mechanism(s): Fill in the type of mechanism(s) that are on file. PRC § 3803 and SMGB Financial Assurance Guideline number 10 describe Surety Bonds, Trust Funds, or Irrevocable Letters of Credit as acceptable financial assurance mechanisms for non-governmental entity operators. For surface mining operations owned and operated by state and local government entities, Surety Bonds, Trust Funds, Irrevocable Letters of Credit, Pledges of Revenue, and Budget Set Aside are acceptable financial assurance mechanisms. State the Financial Assurance Mechanism(s) document number(s). State the dollar amount of each Financial Assurance Mechanism(s) currently on file. State the date of expiration of the Financial Assurance Mechanism(s) currently on file. State the date of approval for the most recent lead agency approved Financial Assurance Mechanism(s) on file. State the total dollar amount of mechanisms held for reclamation. Indicate if any Financial Assurance Mechanisms are pending review by the lead agency and the date and amount of submittal to the lead agency. Indicate if there has been a change of operator of record since the last inspection and, if so, note the date the change occurred and whether the new operator has signed any document acknowledging reclamation responsibility under the approved reclamation plan and if the new operator has posted a Financial Assurance Mechanism. If a replacement Financial Assurance Mechanism has not been posted, indicate the status of the new operator’s replacement Financial Assurance Mechanism.Per PRC § 2773.1(c) and Guideline number 19 of the SMGB’s Financial Assurance Guidelines, when operatorship is transferred, “the original financial assurance must remain in effect until the lead agency has approved, following department review, the replacement assurances provided by the successor operator.” The Financial Assurance amount must be adjusted and approved annually to account for new lands disturbed by surface mining operations and lands to be disturbed in coming year, inflation, and reclamation of lands accomplished in accordance with the approved Reclamation Plan (PRC § 2773.1(a)(3) and SMGB Financial Assurance Guideline #16). In order to determine what adjustments, if any, are appropriate to the Financial Assurance Mechanism amount, each mine operator must submit annually a revision of the written Financial Assurance Cost Estimate to the Lead Agency (PRC § 3804(c)).Provide the date of the operator’s most recent revision of the Financial Assurance Cost Estimate to the Lead Agency and where appropriate, provide a status of the pending Financial Assurance Cost Estimate. Provide the date and amount of the most recently approved Financial Assurance Cost Estimate. Also indicate if the Financial Assurance Cost Estimate is under appeal to the lead agency or whether it has been appealed to State Mining and Geology Board as described in PRC § 2770(e). Use the Financial Assurance “Other” and “Explanation” blocks to provide any other pertinent information regarding the status of Financial Assurance(s). If the operation does not have a sufficient Financial Assurance Cost Estimate and/or Financial Assurance Mechanism, explain in detail. State of California DEPARTMENT OF CONSERVATION OFFICE OF MINE RECLAMATION MRRC-1 (4/97) Page 3 of 5 (Rev. 07/13) SURFACE MINING INSPECTION REPORT VIII. Non-SMARA facility operations conditions solely of local concern (e.g. hours of operation) do not need to be noted here. See Instructions for Block VIII on reverse side of page. [Use separate sheet(s) where necessary. Refer to item numbers below] CA MINE ID # 91- Potential Reclamation Plan Requirements: List Reclamation Plan Requirements (Recommended to be filled out prior to field inspection) Note Site Conditions and Compliance Issues (Note additional comments on Page 5 as necessary) VN? 1) General Information a) Permitted Mineral Product(s) b) Approved Production Amount (Annual/Gross) c) End Date of Operations Per RP d) Permit end date e) End Use 2) Boundaries a) Property Boundary b) Permit Boundary c) Rec. Plan Boundary (RPB) d) Setbacks 3) Slopes –Grading a) Fill Slopes –Note Condition of: i) Slopes –Working (max/current) ii) Slopes –Reclaimed iii) Compaction b) Cut Slopes –Note Condition of: i) Slopes –Working (max./current) ii) Slopes –Reclaimed 4) Erosion Control a) BMPs b) Grading c) Vegetation 5) Ponds a) Design –Function b) Capacity (area/depth/volume) c) Maintenance 6) Stream & Wetland Protection a) Buffers (distance to channel) b) Berms (distance/length/height) c) Best Management Practices d) Drainage e) Grading & Slopes f) Stockpiles g) Stream Diversions 7) Sensitive Wildlife & Plant Protection a) List Species b) Protection Measures DISTRIBUTION: Lead Agency sends copies of Inspection notice & completed MRRC-1 to operator, operator’s designated agent, BLM or USFS (if required) & retains original. 04-0012 a) Sand, Gravel & Clay b) 5,000 - 50,000 tons/annual (5,000 - 50,000 tons/gross) c) September 23, 2003 d) N/A e) Grazing/Open Space Operations include the extraction of sand, gravel and clay. Annual operations are within the approved production amounts. Sufficient clay material and a small amount of aggregates remains to be harvested. Minimal sand deposits are available for extraction. a) 1,439 acres b) 20 acres c) 20 acres d) N/A Operations consist of identifying source materials throughout the property within Dry Creek watershed. Available materials have been identified, and have been harvested over the last 40 years. Excavation areas appear to be within the permitted boundaries of the approved plan. Pits would be excavated to a maximum depth of 10'. Working and final cut slopes will be no steeper than 3:1. The depth of existing and past excavation pits range in size from a foot to 10'. Side slopes vary, with some working slopes exceeding the approved 3:1 ratio. Working slopes are only a few feet in height, and presents minimal safety risk to the public from potential collapse. Final cut slopes on reclaimed slopes are laid back to a 3:1 ratio. The aggregate pits in the eastern portion of the mine site is the only unreclaimed excavation pit remaining on the site. No information on erosion control is provided in the approved reclamation plan. No erosion control measures were being implemented at the site. Erosion is generally contained within the pit areas. No evidence oferosion in reclaimed areas were observed. Past erosion issues fromthe plant site and haul road to the County right-of-way was no longerevident. Erosion was observed along the internal haul roads. No discharge into area waterways were observed. No information on the construction of proposed settling ponds were provided in the approved reclamation plan. Sediment discharge ponds for material processing appeared to function properly. No issues with the pond capacity or with maintenance of the ponds were observed. Only clean materials would be used for creek crossings, which would be removed before heavy rainfall. No additional information on stream and wetland protection measures were identified. No active stream crossings were identified at the site. No information was identified in the approved reclamation plan. INSTRUCTIONS FOR COMPLETING SURFACE MINING INSPECTION REPORT Form MRRC-1 (4/97) Page 3 and 4 (Rev. 07/13) BLOCK VIII: INSTRUCTIONS FOR EACH DATA COLUMN: Potential Reclamation Plan Requirements (Column 1): Under CCR § 3504.5(f), “Inspections may include, but shall not be limited to the following: the operation’s horizontal and vertical dimensions, volumes of materials stored on the site; slope angles of stock piles, waste piles and quarry walls; potential geological hazards; equipment and other facilities; samples of materials; photographic or other electronic images of the operation; any measurements or observations deemed necessary by the inspector or the lead agency to ensure the operation is in compliance with Public Resources Code Chapter 9.” Column 1 provides a list of items that may be included in the approved reclamation plan, either expressly or by reference as described in PRC § 2772(d), which may include conditions of approval, other permit requirements and supplementary documents, including environmental documents, prepared for the project pursuant to Division 13 (commencing with Section 21000). It is not expected that all reclamation plans will include each item of Section VIII, or be limited to the items listed. Items in Column 1 that are not operative requirements in the reclamation plan may not need to be addressed by the inspection. Operative reclamation plan requirements not listed in Items 1 through 12 may be listed in Item 13, under “Other Reclamation Plan Requirements.” Reclamation Plan Requirements (Column 2): Prior to field inspection, it is recommended that the inspector review the approved reclamation plan and any amendments, as well as any other documents included by reference, including conditions of approval, other permit requirements and supplementary documents, such as environmental documents prepared for the project pursuant to Division 13 (commencing with Section 21000) that specifically relate to reclamation of the mine site. The most recently approved Financial Assurance Cost Estimate and any pending or ongoing enforcement actions should also be reviewed. Conditions of approval that relate to facility operations solely of local concern, such as hours of operation, noise, and dust control are not subject to the inspection. Column 2 is intended to provide the inspector a place to match any items noted in Column 1 with those items included in the approved reclamation plan either expressly or by reference as described in PRC § 2772(d), which may include conditions of approval, other permit requirements and supplementary documents, including environmental documents prepared for the project pursuant to Division 13 (commencing with § 21000). Also note any Interim Management Plan (IMP) requirements where the mine is subject to an IMP pursuant to PRC § 2770(h). Indicate the source document for the reclamation plan requirements at the end of the entry in parenthesis; i.e. (COA) (POO) (EIR) (WDR) (SWPPP), etc. Conditions of approval that relate to facility operations solely of local concern, such as hours of operation, noise, and dust control should not be included in Column 2. If items listed in Column 1 of Section VIII of the form are not included in the reclamation plan or other documents included by reference, write not applicable or “NA” in Column 2. Specific reclamation requirements may not apply to an operation at the time of inspection, but they are important to be aware of to ensure current activity at the site will not prohibit reclamation in accordance with the approved reclamation plan. A copy of the Surface Mining and Reclamation Act of 1975 and 1993 SMGB regulations may be obtained at http://www.conservation.ca.gov/omr/lawsandregulations/Pages/SMARA.aspx. Site Conditions and Compliance Issues (Column 3): Describe current site conditions and compliance issues noted for both operating and reclaimed surfaces that pertain to the reclaimed condition of the mining site. Block IX is provided for additional space to describe site conditions and/or compliance issues. Attach additional sheets as necessary. Evaluations of slope stability and engineered compaction should be prepared by qualified professionals only. PRC § 2774(b)) states “The lead agency may cause an inspection to be conducted by a state licensed geologist, state licensed civil engineer, state licensed landscape architect, or state licensed forester, who is experienced in land reclamation and who has not been employed by a surface mining operation within the jurisdiction of the lead agency in any capacity during the previous 12 months.” VN?(Column 4): Use this box to indicate if violations were noted for any of the specific items under the corresponding item group heading (e.g., Boundaries, Slopes-Grading, etc.) during field inspection of the site. Enter number of violations in the box. State of California DEPARTMENT OF CONSERVATION OFFICE OF MINE RECLAMATION MRRC-1 (4/97) Page 4 of 5 (Rev. 07/13) SURFACE MINING INSPECTION REPORT VIII. Non-SMARA facility operations conditions solely of local concern (e.g. hours of operation) do not need to be noted here. See Instructions for Block VIII on reverse side of page. [Use separate sheet(s) where necessary. Refer to item numbers below] CA MINE ID # 91- Potential Reclamation Plan Requirements: List Reclamation Plan Requirements (Recommended to be filled out prior to field inspection) Note Site Conditions and Compliance Issues (Note additional comments on Page 5 as necessary)VN? 8) Soil/Overburden Stockpile Management a) Topsoil i) Location ii) Slope Stability iii) BMPs b) Overburden i) Location ii) Slope Stability iii) BMPs c) Topsoil Application i) Amendments ii) Depth iii) Moisture iv) Application Methods 9) Revegetation a) Test Plots b) Species Mix c) Density d) Percent Cover e) Species Richness f) Protection g) Success Monitoring h) Invasive Species Control 10) Structures 11) Equipment 12) Closure of Adits 13) Other Reclamation Plan Requirements DISTRIBUTION: Lead Agency sends copies of Inspection notice & completed MRRC-1 to operator, operator’s designated agent, BLM or USFS (if required) & retains original. 04-0012 Available topsoil will be removed from the excavation area prior to mining activities, and stockpiled adjacent to the pit. Overburden from site would be backfilled into the pit, if available. Topsoil would then be redistributed over the disturbed area. Typically, in the same year. Mining practices continue to follow the sequence of removing topsoil, backfilling the excavation pit, and then re-distributing the topsoil to revegetate. Sufficient topsoils are located throughout the site to redistribute for reclamation. Current operations would not preclude the site from being reclaimed in accordance with the approved reclamation plan. Disturbed areas will be seeded in the Fall in support of subsequent grazing land uses. No other revegetation information was identified in the approved reclamation plan. Excavation pits throughout the mine site was revegetated with a dryland pasture seed mix, which is consistent with the approved reclamation plan and the on-going agricultural uses. Seeds were broadcasted over the disturbed areas in November. It appears that seeds have germinated, and revegetation efforts will be successful. No information identified in the reclamation plan. All structures are concentrated in the primary processing area and include the scale house, scales, and shop. Soil waste, used oil and solvents would be removed by licensed operators. Various equipment is stored at the site. Diesel storage and othersolvents appear adequately protected, and no leakage was evident. N/A N/A N/A N/A INSTRUCTIONS FOR COMPLETING SURFACE MINING INSPECTION REPORT Form MRRC-1 (4/97) Page 5 (Rev. 05/13) BLOCK IX Inspectors may use the large open block for comments to describe violations, corresponding corrective actions, or preventative measure(s) suggested by the inspector to address noted violations or avoid potential violations, and to explain any limitations on the inspection conducted. The inspector can also use this space to describe the status of any pending or current enforcement actions. Separate violations that are the subject of existing enforcement actions from violations observed during the current inspection. Enter California Mine ID Number and Date of Inspection. Weather Codes: CR = Clear; CL = Cloudy; RN = Rain; SN = Snow; WD = Windy For "Duration of Inspection," indicate the start and end times of the inspection (do not include travel time). SMARA Status Codes (based on annual report and reported production under CCR § 3695, indicate the appropriate status code) I = Idle (Per § 2727.1) NP = Newly Permitted (must be no mining/disturbance) AB = Abandoned (Per § 2770(h)(6)) NOP-NC = Not in operation, reclamation not completed NOP-C = Not in operation, reclamation completed If idle, indicate either the date operation became idle as defined by PRC Section 2727.1, the date an IMP was approved, or the status of any pending IMP. Status of Reclamation Codes: RN = Reclamation not begun P = Post reclamation monitoring R = Reclamation in progress RC = Reclamation complete Enter approximate acreage under reclamation (the number of acres actively being reclaimed in accordance with the approved reclamation plan). Enter approximate acreage determined to be reclaimed in accordance with the approved reclamation plan by Lead Agency. Enter approximate total disturbed acreage. This includes all acreage disturbed by the surface mining operation, as defined by PRC § 2729: “’Mined Lands’ includes the surface, subsurface, and ground water of an area in which surface mining operations will be, are being, or have been conducted, including private ways and roads appurtenant to any such area, land excavations, workings, mining waste, and areas in which structures, facilities, equipment, machines, tools or other materials or property which result from, or are used in, surface mining operations are located.” This should include acreage under reclamation that has not been determined to be reclaimed in accordance with the approved reclamation plan by the Lead Agency. Enter the total number of acres within or adjacent to the disturbance area of the operation disturbed pre-SMARA (disturbance before January 1, 1976, that has not had mining related disturbance after January 1, 1976). Enter the disturbed acreage identified in the most recent Financial Assurance Cost Estimate (i.e., the disturbed acreage that was used to calculate the most recent Financial Assurance Cost Estimate. Enter the date of the previous lead agency inspection and number of violations noted during that inspection. Attendees: Provide the names and affiliations of parties in attendance at the inspection. BLOCK X: Enter the number of violations noted during the inspection. Sign and date the Inspection Report. If the inspector is a consultant to the lead agency, include the inspector’s certification (PE, PG, CEG, etc.) and license number, if applicable. The lead agency may cause an inspection to be performed by contracting with private consultants, specifically: state licensed geologist, state licensed civil engineer, state licensed landscape architect, or state licensed forester per § 2774(b). 2015 Annual Inspection Report Dry Creek Mine/Franklin Aggregates (91‐04‐0012) 1 OBSERVATIONS  The mine site consists of a series of excavation pits throughout the Dry Creek drainage area dating back 40 years, with the current operators having mined the site during the past 20 to 30 years. The drainage area encompasses a large portion of the 1,400 acre property and includes varying amounts of sand, clay and aggregates.  The mine was not active during inspection. Processed and raw materials are stockpiled in the plant site, awaiting processing and export. Minimal excavations occurred during the past year in the aggregate pits, in the eastern portion of the mine site (photo 12).  Operator revegetated past excavation areas that have been previously re‐graded to conform to reclamation standards. A dryland pasture mixture with fertilizer was distributed over disturbed areas with a broadcast seeder. Approximately 6 tons of seed mix was distributed. (see photo 9 & 10)  The aggregate pit (photo 12) has approximately 4.3 acres of available aggregates remaining to be extracted from the total 25 +/‐ acre site. The operator indicated that remaining materials will likely be harvested in 2016. Some extraction equipment remains adjacent to the aggregate pits. A stockpile of aggregates are located adjacent to the pit area (see photo 5).  Excavation of the 25 +/‐ acres of aggregate pit appears to have occurred in 2008‐09. Noxious weeds were dominate over the disturbed areas in 2014. As a result, a Corrective Measure was noted in the 2014 Inspection Report to control and eradicate the growth of weeds on this area, and throughout the mine site. The operator indicated that revegetation efforts in 2015 occurred over the 25 +/‐ acres (see photo 6). Revegetation efforts are anticipated to out compete the noxious weeds present at the site.  Vegetation on the slope edges of the clay excavation pit (see photos 7 & 8) are becoming established. Materials from the clay pits were excavated in 2012‐13. Side slopes were re‐ graded in 2014 to 3:1.  The 5‐acre sand excavation pit, recontoured and revegetated in late 2014 has been reclaimed.  Condition No. 3 of Mining and Reclamation Permit (MRP) 93‐01 states, “The Sycamore tree near pit #5 and the Valley Oak trees near the other pits shall be protected from mining activities. This shall include a no disturbance marking or barriers at a distance of the tree’s drip line (outer canopy) plus ½ that distance.” The Sycamore tree identified in the condition is shown in Photo 11, and appears to be in a good condition. The area around the tree was mined several years ago, and had been reclaimed. No active mining operation appear in close proximity to valley oaks on the property to prompt setting up ‘no disturbance markings or barriers’. Therefore, the operator remains in compliance with this condition.  The plant site is approximately 5 acres in size. The operator indicated that processing equipment will likely be removed after the aggregate pits are exhausted. Stockpiled fines removed from the discharge ponds will be re‐distributed over the disturbed plant site area and revegetated after the plant has been removed and the area re‐contoured. The operator indicated that the on‐site scales (photo 3), office/workshop (photo 2), and the well would remain after reclamation of the mine to support the agriculture end‐use. 2015 Annual Inspection Report Dry Creek Mine/Franklin Aggregates (91‐04‐0012) 2  Equipment and parts, including the concrete culverts and metal bollards that are located adjacent to the plant site, will be removed (see photo 4). A lean‐to shed, and other equipment that are related to the agricultural uses on the property, will remain. VIOLATIONS/CORRECTIVE MEASURES No violations or corrective measures to report. De c e m b e r 1 1 , 2 0 1 5 I n s p e c t i o n P h o t o s – F r a n k l i n A gg r e g a t e s / D r y C r e e k P l a n t M i n e ( 9 1 - 0 4 - 0 0 1 2 ) Ph o t o 1 – A g g r e g a t e s t o c k p i l e a r e a / n e a r p r o ce s s i n g p l a n t . P h o t o 2 – A g g r e g a t e s a w a i t i ng e x p o r t ( f o r e g r o u n d ) . M i n e o f f i c e / w o r k shop (background). Ph o t o 3 – O n - s i t e s c a l e s . P h o t o 4 – C o n c r e t e r u b b le a n d m e t a l b o l l a r d s t o b e r e m o v e d f r o m s i t e . De c e m b e r 1 1 , 2 0 1 5 I n s p e c t i o n P h o t o s – F r a n k l i n A gg r e g a t e s / D r y C r e e k P l a n t M i n e ( 9 1 - 0 4 - 0 0 1 2 ) Ph o t o 5 – S t o c k p i l e o f a g g r e g a t e s i n e a s t e r n p o r t i o n o f m i n e s i t e . P h o t o 6 – R e c l a i m e d a g g r e g at e p i t s i n e a s t e r n p o r t i o n o f mine site. Ph o t o 7 – C l a y e x c a v a t i o n p i t i n 2 0 1 5 . P h o t o 8 – C l a y e x c a v a t i o n p i t i n 2 0 1 4 . De c e m b e r 1 1 , 2 0 1 5 I n s p e c t i o n P h o t o s – F r a n k l i n A gg r e g a t e s / D r y C r e e k P l a n t M i n e ( 9 1 - 0 4 - 0 0 1 2 ) Ph o t o 9 – E x c a v a t i o n p i t ( P i t # 5 i n U s e P e r m i t ) i n 20 1 3 . P h o t o 1 0 – P i t # 5 a f t e r r e c l a m a t i o n . T a k e n i n 2 0 1 5 . Ph o t o 1 1 – S y c a m o r e t r e e n e a r P i t # 5 t h a t i s t h e s u b j e c t of C o n d i t i o n # 3 P h o t o 1 2 – A g g r e g a t e e x c a v a t i o n p i t .